KR193_MOUSE Q925H6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q925H6
Recommended name：Keratin-associated protein 19-3
EC number：
Alternative names：(Keratin-associated protein 16-5) (Keratin-associated protein 16.5)
Cleaved into：
GeneID：77918
Gene names (primary )：Krtap19-3
Gene names (synonym )：Krtap16-5 Krtap16.5
Gene names (ORF )：
Length：87
Mass：8823
Sequence：MSHYSSYYGGLGYGYGSFGGPGCGCNSIRRLVGFGSGYGGFGYGSGFGGFGYGSGYGGYGYGSGFRGYGCGCRRPSCCGGYGFSSFY
Tissue specificity：Strong expression in narrowly defined pattern restricted to the lower and middle cortical regions of the hair shaft in both developing and cycling hair. During hair follicle regression (catagen), expression levels decrease until expression is no longer detectable in follicles at resting stage (telogen). {ECO:0000269|PubMed:15385554}.
Induction：Expression in skin and hair follicle is regulated by HOXC13 and by GATA3. {ECO:0000269|PubMed:11290294, ECO:0000269|PubMed:15385554, ECO:0000269|PubMed:17151017}.
Developmental stage：
Protein families：KRTAP type 19 family