CIART_MOUSE Q3TQ03
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3TQ03
Recommended name：Circadian-associated transcriptional repressor
EC number：
Alternative names：(ChIP-derived repressor of network oscillator) (Chrono) (Computationally highlighted repressor of the network oscillator)
Cleaved into：
GeneID：229599
Gene names (primary )：Ciart
Gene names (synonym )：Gm129
Gene names (ORF )：
Length：375
Mass：40408
Sequence：MDSPSSVSSYSSSSLSPSFSTSSVNSDFSFPSDNEREGKGTHELRPDTVGQRGGSRPSPGPIRCRHRPRVSSNQHTAPHLEQQGSEVKRSRDGEQETSLNTQGCTTEGDLLFAQKCKELQGFIRPLTDLLNGLKMGRFDRGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWFPHIAAQKSSSGGSRHQISKHFPSHHGDPGAASPAPLLEKMGQTQLGHLVLKPKQPWHLTGWPAMNLTWIHSTPICNPPLSSQGSASGHSPIGTGASIGVILVLQKGGQPFTHSAPGTPVPPTPLSPVVPGDLKKLPGEEPRCHSLPVTLPSDWSCILCPPVLPTTDREMTKGHPEPQMTSHPPVAPDPQP
Tissue specificity：
Induction：Expression in the liver oscillates in a circadian manner with highest levels at Zeitgeber time (ZT) 12 hours (at protein level). Expression in the heart, lung, stomach and kidney oscillate in a circadian manner with highest levels at approximately circadian time (CT) 12 hours. Its expression levels peak at circadian time 12 hours (CT12), 8 hours earlier than the peak of PER1/2 and CRY1/2 transcriptional repressors (peak CT20-CT24). Thus, it can repress the CLOCK-ARNTL/BMAL1 activity in a different time window compared to CRY and PER proteins. {ECO:0000269|PubMed:24736997, ECO:0000269|PubMed:24737000}.
Developmental stage：
Protein families：