FSP1_MOUSE   Q8BUE4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BUE4

Recommended name:Ferroptosis suppressor protein 1

EC number:EC 1.6.5.-

Alternative names:(FSP1) (Apoptosis-inducing factor homologous mitochondrion-associated inducer of death) (AMID) (p53-responsive gene 3 protein)

Cleaved into:

GeneID:71361

Gene names  (primary ):Aifm2

Gene names  (synonym ):Amid

Gene names  (ORF ):

Length:373

Mass:40635

Sequence:MGSQVSVDTGAVHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVESGFAKKTFISYSATFKDNFRQGKVIGIDLKNRMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSCQQAAIQAYEDMVKQIQRSQFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSRVPLADKELLPCVRQEVKEILLRKGVQLLLSERVSNLEELPRNEYREYIKVETDKGTEVATNMVIVCNGIKINSSAYRSAFESRLASNGALKVNEFLQVEGYSNIYAIGDCADTKEPKMAYHAGLHANVAVANIVNSMKQRPLKAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLAKSRDLLISTSWKTMRQSPP

Tissue specificity:Detected in most normal tissues as two transcripts of 1.8 and 4.0 kb in length, respectively. Highly expressed in liver, testis, and kidney, and expressed at lower levels in pancreas, spleen, brain and lung (PubMed:16186796). Expressed in heart (at protein level) (PubMed:26689472). {ECO:0000269|PubMed:16186796, ECO:0000269|PubMed:26689472}.

Induction:Expression is up-regulated in mouse embryonic fibroblasts by genotoxic reagents 5-fluorouracil and etoposide (PubMed:16186796). Up-regulated in cardiac cells by anticancer drug doxorubicin (PubMed:26689472). {ECO:0000269|PubMed:16186796, ECO:0000269|PubMed:26689472}.

Developmental stage:

Protein families:FAD-dependent oxidoreductase family


   💬 WhatsApp