PHF5A_MOUSE   P83870


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P83870

Recommended name:PHD finger-like domain-containing protein 5A

EC number:

Alternative names:(PHD finger-like domain protein 5A) (Splicing factor 3B-associated 14 kDa protein) (SF3b14b)

Cleaved into:

GeneID:68479

Gene names  (primary ):Phf5a

Gene names  (synonym ):

Gene names  (ORF ):

Length:110

Mass:12405

Sequence:MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Tissue specificity:Expressed in primary spermatocytes (at protein level) (PubMed:18758164). Ubiquitously expressed in pre- and postnatal tissues (PubMed:12054543). Highly expressed in pluripotent embryonic stem cells (ESCs) (at protein level) and induced pluripotent stem cells (iPSCs) (PubMed:27749823). {ECO:0000269|PubMed:12054543, ECO:0000269|PubMed:18758164, ECO:0000269|PubMed:27749823}.

Induction:Expression levels are down-regulated following differentiation in embryonic stem cells (ESCs) and in differentiated mouse embryonic fibroblasts (MEFs). {ECO:0000269|PubMed:27749823}.

Developmental stage:

Protein families:PHF5 family


   💬 WhatsApp