BDNF_MOUSE P21237
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P21237
Recommended name：Brain-derived neurotrophic factor
EC number：
Alternative names：(BDNF)
Cleaved into：BDNF precursor form (ProBDNF)
GeneID：12064
Gene names (primary )：Bdnf
Gene names (synonym )：
Gene names (ORF )：
Length：249
Mass：28123
Sequence：MTILFLTMVISYFGCMKAAPMKEVNVHGQGNLAYPGVRTHGTLESVNGPRAGSRGLTTTSLADTFEHVIEELLDEDQKVRPNEENHKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Tissue specificity：Expressed in the dorsal root ganglion and the spinal cord (at protein level) (PubMed:28111162). Detected in brain, especially in brain cortex, hippocampus, midbrain and cerebellum (PubMed:2369898, PubMed:8139657). {ECO:0000269|PubMed:2369898, ECO:0000269|PubMed:28111162, ECO:0000269|PubMed:8139657}.
Induction：Expression oscillates in a circadian manner in the suprachiasmatic nucleus (SCN) of the brain (PubMed:23785138). Expressed at higher levels during the dark period and at lower levels during the light period (PubMed:23785138). Up-regulated after sciatic nerve injury (PubMed:28111162). {ECO:0000269|PubMed:23785138, ECO:0000269|PubMed:28111162}.
Developmental stage：
Protein families：NGF-beta family