NUBP1_MOUSE Q9R060
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R060
Recommended name：Cytosolic Fe-S cluster assembly factor NUBP1
EC number：
Alternative names：(Nucleotide-binding protein 1) (NBP 1)
Cleaved into：
GeneID：26425
Gene names (primary )：Nubp1
Gene names (synonym )：
Gene names (ORF )：
Length：320
Mass：34085
Sequence：MEEAPHGCPGADSAQAGRGASCQGCPNQRLCASGAGAAPDPAVEEIREKMKTVRHKLLVLSGKGGVGKSTFSAHLAHGLAEDGDTQVALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVDDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGDVDYLIVDTPPGTSDEHLSVVQYLAAAHIDGAVILTTPQEVALQDVRKEISFCHKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAEAMCQDLRIPLLGKVPLDPHIGKSCDKGQSFFVEAPDSPATAAYRSIIQRIRDFCNSHQSHAETLISP
Tissue specificity：Expressed in trachea epithelial cells, and kidney inner medullary collecting duct cells. {ECO:0000269|PubMed:23807208}.
Induction：High and constant expression in cycling cells. Down-regulated upon cell cycle exit and quiescence. {ECO:0000269|PubMed:23807208}.
Developmental stage：
Protein families：Mrp/NBP35 ATP-binding proteins family, NUBP1/NBP35 subfamily