TIMP3_MOUSE P39876
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P39876
Recommended name：Metalloproteinase inhibitor 3
EC number：
Alternative names：(Tissue inhibitor of metalloproteinases 3) (TIMP-3)
Cleaved into：
GeneID：21859
Gene names (primary )：Timp3
Gene names (synonym )：Sun Timp-3
Gene names (ORF )：
Length：211
Mass：24182
Sequence：MTPWLGLVVLLSCWSLGHWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFSKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYEGKMYTGLCNFVERWDHLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSISNATDP
Tissue specificity：Highest levels are found in kidney, lung and brain followed by ovary and uterus. Low levels are found in bone.
Induction：Highly induced by phorbol ester (PMA), EGF and transforming growth factor-beta 1. Also induced by dexamethasone.
Developmental stage：
Protein families：Protease inhibitor I35 (TIMP) family