AGRP_MOUSE P56473
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P56473
Recommended name：Agouti-related protein
EC number：
Alternative names：
Cleaved into：
GeneID：11604
Gene names (primary )：Agrp
Gene names (synonym )：Agrt Art
Gene names (ORF )：
Length：131
Mass：14432
Sequence：MLTAMLLSCVLLLALPPTLGVQMGVAPLKGIRRPDQALFPEFPGLSLNGLKKTTADRAEEVLLQKAEALAEVLDPQNRESRSPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT
Tissue specificity：Expressed in arcuate nucleus and median eminence, adrenal gland (medulla), hypothalamus, testis, and lung.
Induction：Hypothalamic expression is elevated circa 10-fold in ob/ob and db/db mice.
Developmental stage：
Protein families：