REG3A_MOUSE O09037
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O09037
Recommended name:Regenerating islet-derived protein 3-alpha
EC number:
Alternative names:(REG-3-alpha) (Islet of Langerhans regenerating protein 3) (Lithostathine 3) (Pancreatitis-associated protein 2) (Regenerating islet-derived protein III-alpha) (Reg III-alpha)
Cleaved into:Regenerating islet-derived protein 3-alpha 16.5 kDa form; Regenerating islet-derived protein 3-alpha 15 kDa form
GeneID:19694
Gene names (primary ):Reg3a
Gene names (synonym ):Pap2
Gene names (ORF ):
Length:175
Mass:19539
Sequence:MLPHLVLNSISWMLLSCLLFVFQVQGEDFQKEVPSPRTSCPMGYKAYRSHCYALVMTPKSWFQADLVCQKRPSGHLVSILSGGEASFVSSLVNGRVDNYQDIWIGLHDPTMGQQPNGGGWEWSNSDVLNYLNWDGDPSSTVNRGHCGSLTASSGFLKWGDYYCDGTLPFVCKFKQ
Tissue specificity:Small intestine and pancreas.
Induction:IL17A induces its expression in primary keratinocytes and skin wounds. {ECO:0000269|PubMed:22727489}.
Developmental stage:
Protein families: