C1QL3_MOUSE Q9ESN4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9ESN4
Recommended name：Complement C1q-like protein 3
EC number：
Alternative names：(C1q and tumor necrosis factor-related protein 13) (C1q/TNF-related protein 13) (CTRP13) (Gliacolin)
Cleaved into：
GeneID：227580
Gene names (primary )：C1ql3
Gene names (synonym )：C1ql Ctrp13
Gene names (ORF )：
Length：255
Mass：26687
Sequence：MVLLLVILIPVLVSSAGTSAHYEMLGTCRMVCDPYGGTKAPSTAATPDRGLMQSLPTFIQGPKGEAGRPGKAGPRGPPGEPGPPGPVGPPGEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGYEVLKFDDVVTNLGNHYDPTTGKFTCSIPGIYFFTYHVLMRGGDGTSMWADLCKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLDGGKAHGGNNNKYSTFSGFIIYAD
Tissue specificity：Highly expressed in brain and white adipose tissue. In gonadal fat pad, expressed at lower levels in adipocytes than in the stromal vascular fraction (VSP), which contains preadipocytes, fibroblasts, endothelial cells and occasional immune cells. Expression exhibits sexually dimorphism, with higher levels in females than in males (at protein level). Tends to be up-regulated in adipose tissue from obese males, but not females. Expressed in glial cells. {ECO:0000269|PubMed:21378161}.
Induction：In adipocytes, up-regulated by rosiglitazone, an insulin-sensitizing drug. {ECO:0000269|PubMed:21378161}.
Developmental stage：
Protein families：