OBF1_MOUSE   Q64693


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q64693

Recommended name:POU domain class 2-associating factor 1

EC number:

Alternative names:(B-cell-specific coactivator OBF-1) (BOB-1) (BOB1) (OCA-B) (OCT-binding factor 1)

Cleaved into:

GeneID:18985

Gene names  (primary ):Pou2af1

Gene names  (synonym ):Obf-1

Gene names  (ORF ):

Length:256

Mass:27692

Sequence:MLWQKSTAPEQAPAPPRPYQGVRVKEPVKELLRRKRGHTSVGAAGPPTAVVLPHQPLATYSTVGPSCLDMEVSASTVTEEGTLCAGWLSQPAPATLQPLAPWTPYTEYVSHEAVSCPYSTDMYVQPVCPSYTVVGPSSVLTYASPPLITNVTPRSTATPAVGPQLEGPEHQAPLTYFPWPQPLSTLPTSSLQYQPPAPTLSGPQFVQLPISIPEPVLQDMDDPRRAISSLTIDKLLLEEEESNTYELNHTLSVEGF

Tissue specificity:B-cell specific. {ECO:0000305|PubMed:23045607}.

Induction:In B cells, expression is highly increased upon activation by LPS or CpG. {ECO:0000269|PubMed:23045607}.

Developmental stage:

Protein families:POU2AF1 family


   💬 WhatsApp