ENHO_MOUSE Q8K1D8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8K1D8
Recommended name：Adropin
EC number：
Alternative names：(Energy homeostasis-associated protein)
Cleaved into：
GeneID：69638
Gene names (primary )：Enho
Gene names (synonym )：
Gene names (ORF )：
Length：76
Mass：7927
Sequence：MGAAISQGALIAIVCNGLVGFLLLLLWVILCWACHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
Tissue specificity：Expressed in liver and brain. Expressed in regions of the brain involved in metabolic regulation. {ECO:0000269|PubMed:19041763}.
Induction：In liver, up-regulated in mice fed a high-fat diet for 2 days, and down-regulated in obese mice fed a chronic high fat diet. Also down-regulated in liver 4 hours after treatment with LXR agonist GW3965. {ECO:0000269|PubMed:19041763}.
Developmental stage：
Protein families：