SP7_MOUSE Q8VI67
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VI67
Recommended name：Transcription factor Sp7
EC number：
Alternative names：(C22) (Zinc finger protein osterix)
Cleaved into：
GeneID：170574
Gene names (primary )：Sp7
Gene names (synonym )：Osx
Gene names (ORF )：
Length：428
Mass：44718
Sequence：MASSLLEEEAHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKGGTKKPYADLSAPKTMGDAYPAPFSSTNGLLSPAGSPPAPASGYANDYPPFPHSFPGPTGAQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMHPGGNWLGGGQGQGDGLQGTLSTGPAQPPLNPQLPTYPSDFAPLNPAPYPAPHLLQPGPQHVLPQDVYKPKAVGNSGQLEGSGAAKPPRGAGTGGSGGYAGSGAGRSTCDCPNCQELERLGAAAAGLRKKPIHSCHIPGCGKVYGKASHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELERHVRTHTREKKFTCLLCSKRFTRSDHLSKHQRTHGEPGPGPPPSGPKELGEGRSVGEEEANQPPRSSTSPAPPEKAHGGSPEQSNLLEI
Tissue specificity：Osteoblast/chondrocyte specific. {ECO:0000269|PubMed:11792318}.
Induction：In response to ascorbic acid induction, expression is activated by NFE2L1 in osteoblasts. {ECO:0000269|PubMed:17510056}.
Developmental stage：
Protein families：Sp1 C2H2-type zinc-finger protein family