FGF21_MOUSE Q9JJN1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JJN1
Recommended name：Fibroblast growth factor 21
EC number：
Alternative names：(FGF-21)
Cleaved into：
GeneID：56636
Gene names (primary )：Fgf21
Gene names (synonym )：
Gene names (ORF )：
Length：210
Mass：23237
Sequence：MEWMRSRVGTLGLWVRLLLAVFLLGVYQAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
Tissue specificity：Most abundantly expressed in the liver, also expressed in the thymus at lower levels. {ECO:0000269|PubMed:10858549, ECO:0000269|PubMed:30389664}.
Induction：In the liver, down-regulated in postprandial conditions (PubMed:30389664). Up-regulated at the transcriptional level by CREB3L3 (PubMed:30389664). {ECO:0000269|PubMed:30389664}.
Developmental stage：
Protein families：Heparin-binding growth factors family