EST1F_MOUSE   Q91WU0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91WU0

Recommended name:Carboxylesterase 1F

EC number:EC 3.1.1.1

Alternative names:(Carboxylic ester hydrolase) (Triacylglycerol hydrolase 2) (TGH-2)

Cleaved into:

GeneID:234564

Gene names  (primary ):Ces1f

Gene names  (synonym ):CesML1

Gene names  (ORF ):

Length:561

Mass:61612

Sequence:MFLSTLFLVSLATCVICGNPSSPPVVDTAHGKVLGKHVNVEGFSQPVAVFLGIPFAKPPLGSLRFAPPQPAEPWSSVKNATTYPPMCSQDAARGQAVNDLITNRKEKIHLEFSEDCLYLNIYTPADFSKNSRLPVMVWIHGGGLKLGGASSFDGRALSAYENVVVVAIQYRLSIWGFFSTGDEHSRGNWGHLDQVAALHWVQDNIANFGGDPGSVTIFGESAGGYSVSILILSPLSKNLFHRAISESGVAFIPGMFTKDVRPITEQIAVTAGCKTTTSAVIVHCMRQKTEEELLEIMHKLNLYKLSLQGDTKNSDQFVTSVLDGVVLPKDPKEILAEKNFNTVPYIVGINKQECGWLLPTMTGFLPADVKLDKKKAIALLEQFASMTGIPEDIIPVAVEKYTKGSDDPDQIREGVLDAMGDVAFGVPSVIVSRGHRDTGAPTYMYEYQYYPSFSSPQRPKNVVGDHADDVYSVFGAPILREGASEEEINLSKMVMKFWANFARNGNPNGKGLPHWPKYDQKEGYLHIGGTTQQAQRLKEEEVTFWTQSLAKKQPQPYHNEL

Tissue specificity:Expressed in liver, white and brown adipose tissue, kidney, intestine, adrenal, heart and ovary. Not detected in muscle, lung, testis, brain and spleen. {ECO:0000269|PubMed:16804080}.

Induction:Induced by fasting and repressed by refeeding. {ECO:0000269|PubMed:16804080}.

Developmental stage:

Protein families:Type-B carboxylesterase/lipase family


   💬 WhatsApp