SIA1B_MOUSE Q06985
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q06985
Recommended name：E3 ubiquitin-protein ligase SIAH1B
EC number：EC 2.3.2.27
Alternative names：(RING-type E3 ubiquitin transferase SIAH1B) (Seven in absentia homolog 1b) (Siah-1b) (Siah1b)
Cleaved into：
GeneID：20438
Gene names (primary )：Siah1b
Gene names (synonym )：
Gene names (ORF )：
Length：282
Mass：31122
Sequence：MSRQAATALSTGTSKCPPSQRVPALTDTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAVEKVANSVLFPCKYSASGCEITLPHTKKAEHEELCEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
Tissue specificity：Widely expressed at low level in embryos and adults. Due to the high similarity between SIAH1A and SIAH1B, it is difficult to distinguish its own tissue specificity. Overexpressed in endothelial cells of adult lung. {ECO:0000269|PubMed:12842817, ECO:0000269|PubMed:8404535}.
Induction：Induced by p53/TP53, suggesting that it may be required to modulate p53/TP53 response. {ECO:0000269|PubMed:14985507, ECO:0000269|PubMed:8632996}.
Developmental stage：
Protein families：SINA (Seven in absentia) family