SCIMP_MOUSE Q3UU41
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3UU41
Recommended name：SLP adapter and CSK-interacting membrane protein
EC number：
Alternative names：
Cleaved into：
GeneID：327957
Gene names (primary )：Scimp
Gene names (synonym )：
Gene names (ORF )：
Length：150
Mass：17140
Sequence：MSWWRDNFWIILAMSIIFISLVLGLILYCVCRWQLRQGRNWEIAKPSKQDGRDEEKMYENVLNSSPGQLPALPPRGSPFPGDLAPQEAPRQPSAWYSSVKKVRNKKVFAISGSTEPENDYDDVEIPATTETQHSKTTPFWQAEVGLHSSF
Tissue specificity：Expressed in peripheral blood leukocytes (PBLs) (at protein level) (PubMed:21930792). Expressed in dendritic cells, splenocytes and B cells (at protein level) (PubMed:27288407). Strongly expressed in the spleen and lymph nodes and weakly in other tissues of the immune system, including bone marrow, peripheral blood leukocytes (PBLs) and thymus (PubMed:21930792). Not detected in the majority of nonimmune tissues, with the exception of lung (PubMed:21930792). Expressed in antigen-presenting cells (PubMed:21930792). Expressed in macrophages (PubMed:28098138). {ECO:0000269|PubMed:21930792, ECO:0000269|PubMed:27288407, ECO:0000269|PubMed:28098138}.
Induction：Induced in bone marrow-derived macrophages by CSF2 and particulate beta-glucan. {ECO:0000269|PubMed:27288407}.
Developmental stage：
Protein families：