APOA5_MOUSE Q8C7G5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8C7G5
Recommended name：Apolipoprotein A-V
EC number：
Alternative names：(Apo-AV) (ApoA-V) (Apolipoprotein A5) (Regeneration-associated protein 3)
Cleaved into：
GeneID：66113
Gene names (primary )：Apoa5
Gene names (synonym )：Rap3
Gene names (ORF )：
Length：368
Mass：41262
Sequence：MAAVITWALALLAVFASTQARKSLWDYFSQNSWSKGVMGQPQKLAQENLKGSFEQDLYNMNNYLEKLGPLRGPGKEPPLLAQDPEGIRKQLQQELGEVSSRLEPYMAAKHQQVGWNLEGLRQQLKPYTAELMEQVGLSVQELQEQLRVVGEDTKAQLLGGVDEALNLLQDMQSRVLHHTDRVKELFHPYAERLVTGIGHHVQELHRSVAPHAAASPARLSRCVQTLSHKLTRKAKDLHTSIQRNLDQLRDELSAFIRVSTDGAEDGDSLDPQALSEEVRQRLQAFRHDTYLQIAAFTQAIDQETEEIQHQLAPPPPSHSAFAPELGHSDSNKALSRLQSRLDDLWEDIAYGLQDQGHSHLSDPEGHSG
Tissue specificity：Liver. {ECO:0000269|PubMed:11577099, ECO:0000269|PubMed:11588264}.
Induction：Induced in early phase of liver regeneration.
Developmental stage：
Protein families：Apolipoprotein A1/A4/E family