GSTA1_MOUSE   P13745


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P13745

Recommended name:Glutathione S-transferase A1

EC number:EC 2.5.1.18

Alternative names:(13-hydroperoxyoctadecadienoate peroxidase) (Androst-5-ene-3,17-dione isomerase) (GST class-alpha member 1) (Glutathione S-transferase Ya) (Glutathione S-transferase Ya1)

Cleaved into:Glutathione S-transferase A1, N-terminally processed

GeneID:14857

Gene names  (primary ):Gsta1

Gene names  (synonym ):Gsta Gstya

Gene names  (ORF ):

Length:223

Mass:25608

Sequence:MAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPLLKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ

Tissue specificity:

Induction:Induced in the liver by beta-naphthoflavone (BNF) and 2(3)-t-butyl-4-hydroxyanisole (BHA). {ECO:0000269|PubMed:2049074}.

Developmental stage:

Protein families:GST superfamily, Alpha family


   💬 WhatsApp