SIAH2_MOUSE Q06986
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q06986
Recommended name：E3 ubiquitin-protein ligase SIAH2
EC number：EC 2.3.2.27
Alternative names：(RING-type E3 ubiquitin transferase SIAH2) (Seven in absentia homolog 2) (Siah-2) (mSiah2)
Cleaved into：
GeneID：20439
Gene names (primary )：Siah2
Gene names (synonym )：
Gene names (ORF )：
Length：325
Mass：34758
Sequence：MSRPSSTGPSANKPCSKQPPPPQTPHAPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGAGGGADPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCQ
Tissue specificity：Widely expressed at low level in embryos and adults. Expressed in a specific population of germ cells within both the mouse ovary and testis. Absent in primordial oocytes but expressed in all growing oocytes, coincident with their recruitment from the pool of quiescent cells. Its level of expression increases as the oocytes mature. Expressed in Graafian follicles and in fertilized zygotes up until the two cell stage, a time of extensive maternal transcript degradation and zygotic gene activation. Expressed in the testis from postmeiotic spermatids. {ECO:0000269|PubMed:7895278, ECO:0000269|PubMed:8404535}.
Induction：May be induced by p53/TP53, suggesting that it may be required to modulate p53/TP53 response (PubMed:12417719). The relevance of such activity in vivo is however unclear and may not exist (PubMed:12417719). Induced by ATF4 in response to the unfolded protein response (UPR) (PubMed:24809345). {ECO:0000269|PubMed:12417719, ECO:0000269|PubMed:24809345}.
Developmental stage：
Protein families：SINA (Seven in absentia) family