PLPP1_MOUSE   Q61469


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q61469

Recommended name:Phospholipid phosphatase 1

EC number:EC 3.1.3.-

Alternative names:(35 kDa PAP) (mPAP) (Hydrogen peroxide-inducible protein 53) (Hic53) (Lipid phosphate phosphohydrolase 1) (PAP2-alpha) (Phosphatidate phosphohydrolase type 2a) (Phosphatidic acid phosphatase 2a) (PAP-2a) (PAP2a)

Cleaved into:

GeneID:19012

Gene names  (primary ):Plpp1

Gene names  (synonym ):Hpic53 Lpp1 Ppap2a

Gene names  (ORF ):

Length:283

Mass:31892

Sequence:MFDKTRLPYVALDVICVLLAGLPFAILTSRHTPFQRGIFCNDDSIKYPYKEDTIPYALLGGIVIPFCIIVMSIGESLSVYFNVLHSNSFVGNPYIATIYKAVGAFLFGVSASQSLTDIAKYTIGSLRPHFLAICNPDWSKINCSDGYIEDYICQGNEEKVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRPMLQFGLIAFSIYVGLSRVSDYKHHWSDVTVGLIQGAAMAILVALYVSDFFKDTHSYKERKEEDPHTTLHETASSRNYSTNHEP

Tissue specificity:Widely expressed (PubMed:19215222). Highly expressed in kidney and lung. Almost undetectable in brain, heart, bone, muscle or spleen. {ECO:0000269|PubMed:19215222}.

Induction:Moderately, by hydrogen peroxide, calcium ionophore and dexamethasone. {ECO:0000269|PubMed:7556647}.

Developmental stage:

Protein families:PA-phosphatase related phosphoesterase family


   💬 WhatsApp