JUPI1_MOUSE P97825
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97825
Recommended name：Jupiter microtubule associated homolog 1
EC number：
Alternative names：(Hematological and neurological expressed 1 protein)
Cleaved into：Jupiter microtubule associated homolog 1, N-terminally processed
GeneID：15374
Gene names (primary )：Jpt1
Gene names (synonym )：Hn1
Gene names (ORF )：
Length：154
Mass：16081
Sequence：MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPAEQPVRKNKMASNIFGTPEENPPSWAKSAGSKSSGGREDSESPGTQRSNSSEASSGDFLDLKGEGDMHENVDTDFQANLAQMEEKPVPAAPVPSPVAPAPVPSRRNPPGGKSSLVLG
Tissue specificity：Expressed in yolk sac, fetal brain, brain, spleen and bone marrow. {ECO:0000269|PubMed:9271675}.
Induction：Negatively regulated by the microRNA miR-132. {ECO:0000269|PubMed:25450365}.
Developmental stage：
Protein families：JUPITER family