CPEB2_MOUSE Q812E0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q812E0
Recommended name：Cytoplasmic polyadenylation element-binding protein 2
EC number：
Alternative names：(CPE-BP2) (CPE-binding protein 2) (mCPEB-2)
Cleaved into：
GeneID：
Gene names (primary )：Cpeb2
Gene names (synonym )：
Gene names (ORF )：
Length：521
Mass：58442
Sequence：MNLPQQQPPAAAPQQPQSRRSPVSPQLQQQHQAAAAAFLQQRNSYNHHQPLLKQSPWSNHQNSGWGTASMSWGAMHGRDHRRSGNMGIPGTMNQISPLKKPFSGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQVRSSLQLPAWGSDSLQDSWCTAAGTSRIDQDRSRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNGRSSLFPIDDSLLDDGHSDQVGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRWN
Tissue specificity：Expressed in embryo, cerebellum, salivary gland, thymus, heart, liver, lung, spleen, kidney, intestine, ovary and round spermatids. Weakly expressed in granular cells of dentate gyrus and the pyramidal cells of CA3 and CA1 of the hippocampus. {ECO:0000269|PubMed:12672660, ECO:0000269|PubMed:12871996}.
Induction：Not induced by kainate. {ECO:0000269|PubMed:12871996}.
Developmental stage：
Protein families：RRM CPEB family