APEL_MOUSE   Q9R0R4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9R0R4

Recommended name:Apelin

EC number:

Alternative names:(APJ endogenous ligand)

Cleaved into:Apelin-36; Apelin-31; Apelin-28; Apelin-13

GeneID:30878

Gene names  (primary ):Apln

Gene names  (synonym ):Apel

Gene names  (ORF ):

Length:77

Mass:8658

Sequence:MNLRLCVQALLLLWLSLTAVCGVPLMLPPDGTGLEEGSMRYLVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF

Tissue specificity:Expressed in extraembryonic visceral endoderm and in the primitive streak at 6.5 and 7.5 dpc (PubMed:28854362). Expressed in the anterior visceral yolk sac at 8.25 dpc (PubMed:28854362). Expressed weakly in the embryonic heart at 11.5 dpc (PubMed:26611206). Expressed in the adult heart (PubMed:26611206). Expressed in endothelial cells and cardiomyocytes and weakly expressed in fibroblasts (PubMed:26611206). {ECO:0000269|PubMed:26611206, ECO:0000269|PubMed:28854362}.

Induction:Not up-regulated following myocardial infarction (MI) (at protein level) (PubMed:26611206). {ECO:0000269|PubMed:26611206}.

Developmental stage:

Protein families:Apelin family


   💬 WhatsApp