TNR9_MOUSE P20334
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P20334
Recommended name：Tumor necrosis factor receptor superfamily member 9
EC number：
Alternative names：(4-1BB ligand receptor) (T-cell antigen 4-1BB) (CD antigen CD137)
Cleaved into：
GeneID：21942
Gene names (primary )：Tnfrsf9
Gene names (synonym )：Cd137 Ila Ly63
Gene names (ORF )：
Length：256
Mass：27598
Sequence：MGNNCYNVVVIVLLLVGCEKVGAVQNSCDNCQPGTFCRKYNPVCKSCPPSTFSSIGGQPNCNICRVCAGYFRFKKFCSSTHNAECECIEGFHCLGPQCTRCEKDCRPGQELTKQGCKTCSLGTFNDQNGTGVCRPWTNCSLDGRSVLKTGTTEKDVVCGPPVVSFSPSTTISVTPEGGPGGHSLQVLTLFLALTSALLLALIFITLLFSVLKWIRKKFPHIFKQPFKKTTGAAQEEDACSCRCPQEEEGGGGGYEL
Tissue specificity：Expressed on the surface of activated T-cells.
Induction：Optimal by PMA and ionomycin.
Developmental stage：
Protein families：