CP239_MOUSE P56656
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P56656
Recommended name：Cytochrome P450 2C39
EC number：EC 1.14.14.1
Alternative names：(CYPIIC39)
Cleaved into：
GeneID：13098
Gene names (primary )：Cyp2c39
Gene names (synonym )：
Gene names (ORF )：
Length：490
Mass：55827
Sequence：MDLVTFLVLTLSSLILLSLWRQSCGRGSLPPGPTPFPIIGNFLQIDIKNVSQSLTNFSKAYGPVFTLYLGSRPTVVLHGYEAVKEALIDHGEEFSDRGSIPMVEKINNGLGIVFSNGNRWKEIRRFTLTTLRNLGMGKRNIEDRVQEEAQCLVEELRKTKGSPCDPTFILSCAPCNVICSIIFQDRFDYKDKDFLMLMEKLNENVKILSSPWLQVCNNFPLLIDYCPGSHHKVLKNVKYIRSYLLEKIKEHQESLDVTNPRDFIDYYLIKQKQANHIQQAEFSLENLACTINNLFAAGTETTSTTLRYALLLLMKYPDVTAKVQEEIDHVIGRHRSPCMQDRNHMPYTDAMIHEVQRFINLVPNNIPRAVTCDIKFRNYLIPKGTTVVTSLTSVLHDSKEFPNPELFDPGHFLDANGNFKKSDHFMPFSAGKRVCAGEGLARMELFLFLTTILQNFKLKSLVHPKDIDMIPFVNGLIALPPHYQVCIIPR
Tissue specificity：Liver.
Induction：P450 can be induced to high levels in liver and other tissues by various foreign compounds, including drugs, pesticides, and carcinogens.
Developmental stage：
Protein families：Cytochrome P450 family