NUD15_MOUSE Q8BG93
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BG93
Recommended name：Nucleotide triphosphate diphosphatase NUDT15
EC number：EC 3.6.1.9
Alternative names：(MutT homolog 2) (mMTH2) (Nucleoside diphosphate-linked moiety X motif 15) (Nudix motif 15) (Nucleoside diphosphate-linked to another moiety X hydrolase 15) (Nudix hydrolase 15)
Cleaved into：
GeneID：214254
Gene names (primary )：Nudt15
Gene names (synonym )：Mth2
Gene names (ORF )：
Length：170
Mass：19576
Sequence：MAANAEPRRRPGVGVGVVVLSCEHPRCVLLGKRKGSFGAGSFQLPGGHLEFGETWEECAQRETWEEAGLHLKNVCFASVVNSFVEKENYHYVTILMKGEVDMTHDSEPRNMEPEKNESWEWVPWEEFPPLDQLFWALRCLKEQGYDPFKEDLNHLEGYRGEHLERTTKTP
Tissue specificity：
Induction：Progressive reduction of protein levels after 4 month of age in the hippocampus of SAMP8 mouse, a mouse with early aging syndrome and reduced ability of learning and memory. {ECO:0000269|PubMed:19735921}.
Developmental stage：
Protein families：Nudix hydrolase family