UBD_MOUSE P63072
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63072
Recommended name：Ubiquitin D
EC number：
Alternative names：(Diubiquitin) (Ubiquitin-like protein FAT10)
Cleaved into：
GeneID：24108
Gene names (primary )：Ubd
Gene names (synonym )：Fat10
Gene names (ORF )：
Length：162
Mass：18376
Sequence：MASVRTCVVRSDQWRLMTFETTENDKVKKINEHIRSQTKVSVQDQILLLDSKILKPHRKLSSYGIDKETTIHLTLKVVKPSDEELPLFLVESKNEGQRHLLRVRRSSSVAQVKEMIESVTSVIPKKQVVNCNGKKLEDGKIMADYNIKSGSLLFLTTHCTGG
Tissue specificity：Mostly expressed in thymus and intestine. {ECO:0000269|PubMed:16782901}.
Induction：Rapidly degraded by the proteasome. Cell-cycle regulation with highest expression during the S-phase (at protein level). Over expressed in hepatocytes by drug injury (e.g. DDC; diethyl 1,4-dihydro-2,4,6-trimethyl-3,5-pyridinedicarboxylate). Inducible by the proinflammatory cytokines tumor necrosis factor-alpha (TNFa) and interferon-gamma (IFNg). {ECO:0000269|PubMed:11445583, ECO:0000269|PubMed:16782901, ECO:0000269|PubMed:18280469}.
Developmental stage：
Protein families：