HEPC_MOUSE   Q9EQ21


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9EQ21

Recommended name:Hepcidin

EC number:

Alternative names:

Cleaved into:

GeneID:84506

Gene names  (primary ):Hamp

Gene names  (synonym ):Hamp1 Hepc Hepc1

Gene names  (ORF ):

Length:83

Mass:9352

Sequence:MALSTRTQAACLLLLLLASLSSTTYLHQQMRQTTELQPLHGEESRADIAIPMQKRRKRDTNFPICIFCCKCCNNSQCGICCKT

Tissue specificity:Highly expressed in the liver and to a much lesser extent in the heart. Secreted in blood (PubMed:15124018). {ECO:0000269|PubMed:11113132, ECO:0000269|PubMed:12729891, ECO:0000269|PubMed:15124018}.

Induction:Regulated in response to changes in circulating iron concentrations, iron stores or the development of inflammation and iron-restricted erythropoiesis. Down-regulated following anemia induced by hemorrhage or hemolysis: down-regulation is mediated by ERFE (PubMed:12370282, PubMed:24880340, PubMed:15124018). The induction of upon inflammation is mediated by IL6 (PubMed:15124018). {ECO:0000269|PubMed:12370282, ECO:0000269|PubMed:15124018, ECO:0000269|PubMed:24880340}.

Developmental stage:

Protein families:Hepcidin family


   💬 WhatsApp