REM1_MOUSE O35929
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35929
Recommended name：GTP-binding protein REM 1
EC number：
Alternative names：(Rad and Gem-like GTP-binding protein 1)
Cleaved into：
GeneID：19700
Gene names (primary )：Rem1
Gene names (synonym )：Rem
Gene names (ORF )：
Length：297
Mass：32909
Sequence：MTLNTQQEAKTTLRRRASTPLPLSSRGHQPGRLCTAPSAPSQHPRLGQSVSLNPPVRKPSPAQDGWSSESSDSEGSWEALYRVVLLGDPGVGKTSLASLFAEKQDRDPHEQLGGVYERTLSVDGEDTTLVVMDTWEAEKLDESWCQESCLQAGSAYVIVYSIADRSSFESASELRIQLRRTHQANHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIETSATLQHNVTELFEGVVRQLRLRRQDNAAPETPSPRRRASLGQRARRFLARLTARSARRRALKARSKSCHNLAVL
Tissue specificity：High expression in cardiac muscle. Moderate expression in lung, skeletal muscle and kidney. Low levels in spleen and brain.
Induction：Repressed by lipopolysaccharide stimulation.
Developmental stage：
Protein families：Small GTPase superfamily, RGK family