SAMD5_MOUSE   Q3V1H9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3V1H9

Recommended name:Sterile alpha motif domain-containing protein 5

EC number:

Alternative names:(SAM domain-containing protein 5)

Cleaved into:

GeneID:320825

Gene names  (primary ):Samd5

Gene names  (synonym ):

Gene names  (ORF ):

Length:173

Mass:19221

Sequence:MCTNIVYEWLRALQLPQYAESFVDNGYDDLEVCKQIGDPDLDAIGVLAPAHRRRILEAVHRLREQDAAAAGLYFTLEPQPVPPAPLVEAVPPGRRGEPCGSSAQGTRGDPRGQPGAPCSRELVSYPKLKLKIMIRDKLVRDGIHLSKPPYSRKVPMAGILEYLMNWPKSSQNH

Tissue specificity:Detected in kidney glomeruli, and in peribiliary gland (PBG) cells at the hepatic hilum (at protein level). Detected in liver, kidney and small intestine. {ECO:0000269|PubMed:28388653}.

Induction:Strongly induced in EPCAM-positive liver cells in response to liver damage caused by long-term 3,5-diethoxycarbonyl-1,4-dihydro-collidine (DDC) feeding. {ECO:0000269|PubMed:28388653}.

Developmental stage:

Protein families:


   💬 WhatsApp