CST8_MOUSE P32766
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P32766
Recommended name：Cystatin-8
EC number：
Alternative names：(Cystatin-related epididymal spermatogenic protein) (Cystatin-related epididymal-specific protein)
Cleaved into：
GeneID：13012
Gene names (primary )：Cst8
Gene names (synonym )：Cres
Gene names (ORF )：
Length：142
Mass：16288
Sequence：MAKPLWLSLILFIIPVALAVGVDQSKNEVKAQNYFGSINISNANVKQCVWFAMKEYNKESEDKYVFLVDKILHAKLQITDRMEYQIDVQISRSNCKKPLNNTENCIPQKKPELEKKMSCSFLVGALPWNGEFNLLSKECKDV
Tissue specificity：Proximal caput region of the epididymis. Lower expression in the testis. Within the testis it is localized to the elongating spermatids, whereas within the epididymis it is exclusively synthesized by the proximal caput epithelium.
Induction：Testicular factors or hormones other than androgens present in the testicular fluid may be involved in the regulation of CRES gene expression.
Developmental stage：
Protein families：Cystatin family