S10A4_MOUSE   P07091


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P07091

Recommended name:Protein S100-A4

EC number:

Alternative names:(Metastasin) (Metastatic cell protein) (PEL98) (Placental calcium-binding protein) (Protein 18A2) (Protein Mts1) (S100 calcium-binding protein A4)

Cleaved into:

GeneID:20198

Gene names  (primary ):S100a4

Gene names  (synonym ):Capl Mts1

Gene names  (ORF ):

Length:101

Mass:11721

Sequence:MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSFLGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK

Tissue specificity:Specifically expressed in different metastatic cells.

Induction:The mRNA coding for this protein increases in abundance after serum stimulation of quiescent mouse fibroblasts.

Developmental stage:

Protein families:S-100 family


   💬 WhatsApp