NGAL_MOUSE   P11672


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P11672

Recommended name:Neutrophil gelatinase-associated lipocalin

EC number:

Alternative names:(NGAL) (Lipocalin-2) (Oncogene 24p3) (24p3) (SV-40-induced 24p3 protein) (Siderocalin LCN2) (p25)

Cleaved into:

GeneID:16819

Gene names  (primary ):Lcn2

Gene names  (synonym ):

Gene names  (ORF ):

Length:200

Mass:22875

Sequence:MALSVMCLGLALLGVLQSQAQDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN

Tissue specificity:Detected in lung, spleen, uterus, vagina and epididymis. {ECO:0000269|PubMed:8687399}.

Induction:Upon Toll-like receptor (TLRs) stimuli. By SV-40. {ECO:0000269|PubMed:15531878}.

Developmental stage:

Protein families:Calycin superfamily, Lipocalin family


   💬 WhatsApp