NEUM_MOUSE P06837
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P06837
Recommended name：Neuromodulin
EC number：
Alternative names：(Axonal membrane protein GAP-43) (Calmodulin-binding protein P-57) (Growth-associated protein 43)
Cleaved into：
GeneID：14432
Gene names (primary )：Gap43
Gene names (synonym )：Basp2
Gene names (ORF )：
Length：227
Mass：23632
Sequence：MLCCMRRTKQVEKNDEDQKIEQDGVKPEDKAHKAATKIQASFRGHITRKKLKGEKKGDAPAAEAEAKEKDDAPVADGVEKKEGDGSATTDAAPATSPKAEEPSKAGDAPSEEKKGEGDAAPSEEKAGSAETESAAKATTDNSPSSKAEDGPAKEEPKQADVPAAVTDAAATTPAAEDAATKAAQPPTETAESSQAEEEKDAVDEAKPKESARQDEGKEDPEADQEHA
Tissue specificity：Expressed in the hippocampus (at protein level) (PubMed:18493953, PubMed:11573004). Expressed in the dorsal root ganglion and the spinal cord (at protein level) (PubMed:28111162). {ECO:0000269|PubMed:11573004, ECO:0000269|PubMed:18493953, ECO:0000269|PubMed:28111162}.
Induction：Up-regulated after memory training in radial arm maze experiments (PubMed:11573004). Up-regulated after sciatic nerve injury (PubMed:28111162). {ECO:0000269|PubMed:11573004, ECO:0000269|PubMed:28111162}.
Developmental stage：
Protein families：Neuromodulin family