YPEL3_MOUSE P61237
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61237
Recommended name：Protein yippee-like 3
EC number：
Alternative names：(Small ubiquitinated apoptotic protein)
Cleaved into：
GeneID：66090
Gene names (primary )：Ypel3
Gene names (synonym )：Suap
Gene names (ORF )：
Length：119
Mass：13608
Sequence：MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD
Tissue specificity：Widely expressed. Strongly expressed in heart, brain, testis, lung, spleen, liver, kidney and myeloid cells. {ECO:0000269|PubMed:12566317, ECO:0000269|PubMed:15556292}.
Induction：Up-regulated after the removal of interleukin 3 and exposure to granulocyte colony stimulating factor. {ECO:0000269|PubMed:12566317}.
Developmental stage：
Protein families：Yippee family