ZFAN5_MOUSE O88878
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88878
Recommended name：AN1-type zinc finger protein 5
EC number：
Alternative names：(Zinc finger A20 domain-containing protein 2) (Zinc finger protein 216)
Cleaved into：
GeneID：22682
Gene names (primary )：Zfand5
Gene names (synonym )：Za20d2 Zfp216 Znf216
Gene names (ORF )：
Length：213
Mass：23058
Sequence：MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPTSDSASVQRADAGLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSSSQSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRYSDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI
Tissue specificity：Expressed in brain, muscle, eye, and heart, lower expression in lung, kidney, and spleen, and very low expression in liver. Expressed in myoblast C2C12 cells (at protein level). {ECO:0000269|PubMed:14754897, ECO:0000269|PubMed:9758550}.
Induction：Up-regulated after TNFSF11 stimulation. Expression also induced by other cytokines such as TNF and IL1B. No significant inhibitory effect on the NF-kappa-B pathway is observed. Expression is increased in both denervation- and fasting-induced muscle atrophy. {ECO:0000269|PubMed:16194934}.
Developmental stage：
Protein families：