SYJ2B_MOUSE   Q9D6K5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D6K5

Recommended name:Synaptojanin-2-binding protein

EC number:

Alternative names:(Activin receptor-interacting protein 2) (Activin receptor-interacting protein 4) (Mitochondrial outer membrane protein 25)

Cleaved into:

GeneID:105940408

Gene names  (primary ):Synj2bp

Gene names  (synonym ):Arip2 Omp25

Gene names  (ORF ):

Length:145

Mass:15815

Sequence:MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKEDGAAAQDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGCAVSLRVQHRLPVQNGPIVHRGEGEPSGVPVAMVLLPVFALTMVAVWAFVRYRKQL

Tissue specificity:Isoform 1 and isoform 2 are widely expressed, notably in brain, heart, lung, liver, kidney, skeletal muscle, ovary and testis. Isoform 3 is detected only in heart, spleen and testis. {ECO:0000269|PubMed:11882656, ECO:0000269|PubMed:16648306}.

Induction:Up-regulated between 12 and 24 hours after treatment with activin A and lipopolysaccharide (LPS). Down-regulated by calcium ionophore A23187. {ECO:0000269|PubMed:17907296}.

Developmental stage:

Protein families:


   💬 WhatsApp