CP4CA_MOUSE Q91WL5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91WL5
Recommended name：Cytochrome P450 4A12A
EC number：EC 1.14.14.1
Alternative names：(CYPIVA12)
Cleaved into：
GeneID：277753
Gene names (primary )：Cyp4a12a
Gene names (synonym )：Cyp4a12
Gene names (ORF )：
Length：508
Mass：58350
Sequence：MSASALSSIRFPGSISEYLQVASVLSLLLLLFKTAQLYLHRQWLLSSTQQFPSPPSHWLFGHKILKDQDLQDILTRIKNFPSACPQWLWGSKVRIQVYDPDYMKLILGRSDPKANGSYRFLAPWIGRGLLMLDGQTWFQHRRMLTPAFHYDILKPYTEIMADSVRVMLDKWEQIVGQDSTLEIFRHITLMTLDTIMKCAFSHEGSVQLDRKYKSYIQAVEDLNDLVFSRVRNIFHQNDIIYRVSSNGCKANSACKLAHDHTDQVIKSRRIQLQDEEELEKLKKKRRLDFLDILLFARMENGKSLSDKDLRAEVDTFMFEGHDTTASGISWIFYALATNPEHQQRCRKEIQSLLGDGTSITWNDLDKMPYTTMCIKEALRIYPPVPSVSRELSSPVTFPDGRSLPKGIHVMLSFYGLHHNPTVWPNPEVFDPSRFAPGSSRHSHSFLPFSGGARNCIGKQFAMNELKVAVALTLLRFELLPDPTRVPIPIPRIVLKSKNGIHLHLKKLQ
Tissue specificity：Gender- and strain-specific expression in kidney (at protein level). Predominantly expressed in males, the expression among strains decreasing in the following order: NMRI > FVB/N > 129 Sv/J > Balb/c > C57BL/6. Expressed in renal arterioles. {ECO:0000269|PubMed:17112342}.
Induction：Up-regulated by 5alpha-dihydrotestosterone. {ECO:0000269|PubMed:17112342}.
Developmental stage：
Protein families：Cytochrome P450 family