SLPI_MOUSE P97430
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97430
Recommended name：Antileukoproteinase
EC number：
Alternative names：(ALP) (Secretory leukocyte protease inhibitor)
Cleaved into：
GeneID：20568
Gene names (primary )：Slpi
Gene names (synonym )：
Gene names (ORF )：
Length：131
Mass：14308
Sequence：MKSCGLLPFTVLLALGILAPWTVEGGKNDAIKIGACPAKKPAQCLKLEKPQCRTDWECPGKQRCCQDACGSKCVNPVPIRKPVWRKPGRCVKTQARCMMLNPPNVCQRDGQCDGKYKCCEGICGKVCLPPM
Tissue specificity：Detected in bronchial epithelial cells (PubMed:18322212). Detected in bronchoalveolar fluid after infection with M.tuberculosis (at protein level) (PubMed:18322212). Highest expression in lung, spleen, intestine and epididymis with lower levels in liver and seminal vesicle. No expression in brain, heart, kidney and muscle. {ECO:0000269|PubMed:18322212, ECO:0000269|PubMed:9039268, ECO:0000269|PubMed:9126337, ECO:0000269|PubMed:9351627}.
Induction：Up-regulated by bacterial lipopolysaccharide (PubMed:9039268, PubMed:25030421). Up-regulated in lung after infection with M.tuberculosis (PubMed:18322212). Down-regulated by IFNG (PubMed:9039268). Up-regulated in lung in response to bacterial pneumonia (PubMed:9351627). Up-regulated in macrophages after exposure to L.major (PubMed:25030421). Not up-regulated in spleen in response to bacterial pneumonia (PubMed:9351627). Up-regulated in wounded skin (PubMed:11017147). {ECO:0000269|PubMed:11017147, ECO:0000269|PubMed:18322212, ECO:0000269|PubMed:25030421, ECO:0000269|PubMed:9039268, ECO:0000269|PubMed:9351627}.
Developmental stage：
Protein families：