NGP_MOUSE O08692
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O08692
Recommended name：Neutrophilic granule protein
EC number：
Alternative names：(NGP) (Cystatin-like protein) (Myeloid bactenecin protein) (Myeloid secondary granule protein)
Cleaved into：
GeneID：18054
Gene names (primary )：Ngp
Gene names (synonym )：
Gene names (ORF )：
Length：167
Mass：19332
Sequence：MAGLWKTFVLVVALAVVSCEALRQLRYEEIVDRAIEAYNQGRQGRPLFRLLSATPPSSQNPATNIPLQFRIKETECTSTQERQPKDCDFLEDGEERNCTGKFFRRRQSTSLTLTCDRDCSREDTQETSFNDKQDVSEKEKFEDVPPHIRNIYEDAKYDIIGNILKNF
Tissue specificity：Expressed in myeloid bone marrow cells. Expressed in neutrophilic precursors (at protein level) (PubMed:8749713). Expressed in myeloid bone marrow cells (PubMed:21518852). {ECO:0000269|PubMed:21518852, ECO:0000269|PubMed:8749713}.
Induction：Up-regulated by CCAAT/enhancer-binding proteins CEBPA and CEBPE and transcription factor SPI1 (at protein level) (PubMed:12515729). Down-regulated in malignant tumor conditioned medium (PubMed:21518852). Up-regulated during early bone marrow differentiation by the granulocyte-macrophage colony-stimulating factor CSF2 and down-regulated during granulocytic maturation (PubMed:8749713). {ECO:0000269|PubMed:12515729, ECO:0000269|PubMed:21518852, ECO:0000269|PubMed:8749713}.
Developmental stage：
Protein families：Cathelicidin family