HSDL2_MOUSE   Q2TPA8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q2TPA8

Recommended name:Hydroxysteroid dehydrogenase-like protein 2

EC number:EC 1.-.-.-

Alternative names:

Cleaved into:

GeneID:72479

Gene names  (primary ):Hsdl2

Gene names  (synonym ):

Gene names  (ORF ):

Length:490

Mass:54208

Sequence:MLPNTGKLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTTQKHPKLLGTIYTAAEEIEAAGGTALPCVVDVRDEQQINSAVEKAVEKFGGIDILVNNASAISLTNTLDTPTKRVDLMMNVNTRGTYLTSKACIPFLKKSKVGHILNLSPPLNLNPLWFKQHCAYTIAKYGMSMCVLGMAEEFRGEIAVNALWPRTAIHTAAMDMLGGSGVENQCRKVDIIADAAYSIFKRPKSFTGNFIIDENILKEEGIKNFDVYAIAPGHPLLPDFFLDEHPDAVMEEKESNDSVPEVKEEKLQLQEESQLQKQPQLQEQPQLQEKPQLQEKPQLQEQPQLQEKPQLQEQPQQREQPQLQQQPRPRQQPQPFVQSMLPQKPHFGAVEETFRIVKDSLSDEVVRATQAVYQFELSGEDGGTWFLDLKSKGGKVGHGEPSDRADVVMSMATDDFVKMFSGKLKPTMAFMSGKLKIKGNIALAIKLEKLMTQMNSRL

Tissue specificity:Widely expressed. {ECO:0000269|PubMed:16240713}.

Induction:Up-regulated by cholesterol-rich food. {ECO:0000269|PubMed:16240713}.

Developmental stage:

Protein families:Short-chain dehydrogenases/reductases (SDR) family


   💬 WhatsApp