SRTD2_MOUSE Q9JJG5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JJG5
Recommended name：SERTA domain-containing protein 2
EC number：
Alternative names：(Transcriptional regulator interacting with the PHD-bromodomain 2) (TRIP-Br2)
Cleaved into：
GeneID：58172
Gene names (primary )：Sertad2
Gene names (synonym )：Kiaa0127
Gene names (ORF )：MNCb-1504
Length：309
Mass：33312
Sequence：MLGKGGKRKFDEHEDGLEGKIVSPSDGPSRVSYTLQRQTIFNISLMKLYNHRPLTEPSLQKTVLINNMLRRIQEELKQEGSLRPAFTPSSQPSNSLSDSYQEAPPPAPHPCDLGSTTPLEACLTPASLLEDDNDDTFCTLQAVHPAAPTRLSSAALPAEKDSFSSALDEIEELCPTSTSTEAAHTAAPEGPKGTSSESSVQKPEGPEEGRTDDSRFMDSLPGNFEITTSTGFLTDLTLDDILFADIDTSMYDFDPCTSASGTASKMAPVSADDLLKTLAPYSNQPVAPSQPFKMDLTELDHIMEVLVGS
Tissue specificity：Expressed in white and brown adipose tissue. {ECO:0000269|PubMed:23291629}.
Induction：Up-regulated by high fat diet in adipose tissue. {ECO:0000269|PubMed:23291629}.
Developmental stage：
Protein families：