RES18_MOUSE P47939
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P47939
Recommended name：Regulated endocrine-specific protein 18
EC number：
Alternative names：
Cleaved into：
GeneID：19711
Gene names (primary )：Resp18
Gene names (synonym )：
Gene names (ORF )：
Length：175
Mass：19485
Sequence：MQSSLKPAGSGHLQLLVCFLLLYSRPGSCSDINAHDGQGQVGSEQLWTFQGLIASVFQYLQLIFHQIVPEGMFWADDIAYELMTKKVEHLSRLHPQYPCRKDMKAVSPTANAGVRSKQEEKLQLLSPQKSPTVKVNRDRCFTTKVIPKATKQEATHPTKGFFGPFPTVGLNLVAD
Tissue specificity：Pituitary, hypothalamus and pancreas. Highest levels are found in somatotrophes, mammotrophes, and gonadotrophes, and lower levels are found in corticotrophs and thyrotropes. {ECO:0000269|PubMed:17951542}.
Induction：Up-regulated by high levels of glucose. {ECO:0000269|PubMed:17951542}.
Developmental stage：
Protein families：RESP18 family