HEXI1_MOUSE Q8R409
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R409
Recommended name：Protein HEXIM1
EC number：
Alternative names：(Cardiac lineage protein 1)
Cleaved into：
GeneID：192231
Gene names (primary )：Hexim1
Gene names (synonym )：Clp1
Gene names (ORF )：
Length：356
Mass：40243
Sequence：MAEPLLTEHQHQPQTSNCTGAAVVHEEHTSERPPSAEERVPKEDSRWQSRASLQSGSRPGQEGEGGLKHQLPPLQTNACPELSSLEKGEKGQNGEDLSTGGASPSAEGEPMSESLVQPGHDSEATKQEAPAAGGEEPWGQQQRQLGKKKHRRRPSKKKRHWKPYYKLTWEEKKKFDEKQSLRASRVRAEMFAKGQPVAPYNTTQFLMDDHDQEEPDLKTGLYPKRAAAKSDDTSDEDFVEEAGEEDGGSDGMGGDGSEFLQRDFSETYERYHAESLQNMSKQELIKEYLELEKCLSRKEDENNRLRLESKRLGGVDARVRELELELDRLRAENLQLLTENELHRQQERAPLSKFGD
Tissue specificity：Widely expressed with higher expression in heart, skeletal muscle and brain (at protein level). {ECO:0000269|PubMed:12119119}.
Induction：Up-regulated by HMBA (hexamethylene bisacetamide). {ECO:0000269|PubMed:12119119}.
Developmental stage：
Protein families：HEXIM family