DEPP1_MOUSE   Q8K2F3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8K2F3

Recommended name:Protein DEPP1

EC number:

Alternative names:(Fat-specific-expressed gene protein) (Protein DEPP)

Cleaved into:

GeneID:213393

Gene names  (primary ):Depp1

Gene names  (synonym ):Depp Fseg

Gene names  (ORF ):

Length:205

Mass:22525

Sequence:MRSRLLLPVPHLPTIREMSEELSHGAAGQEPPASPSLDDYVRCICQLAQPTSVLDKVTAQSRPNRPSRPAWTREKRRQAESPGDSSLCVSSLQPTLPSPGTDNPLDWLFGKSQGEQADGRGRPNRTGSSDPWDVPRQMGKDTGRLCEARVPEHSLGRKPGPRHQTSDLKSWTSRKSCRALASVSSSRPSSILGTLYLHLPVIHEL

Tissue specificity:

Induction:Up-regulated by hypoxia. {ECO:0000269|PubMed:24530860}.

Developmental stage:

Protein families:


   💬 WhatsApp