IIGP1_MOUSE Q9QZ85
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QZ85
Recommended name:Interferon-inducible GTPase 1
EC number:EC 3.6.5.-
Alternative names:
Cleaved into:
GeneID:60440
Gene names (primary ):Iigp1
Gene names (synonym ):Irga6
Gene names (ORF ):
Length:413
Mass:47572
Sequence:MGQLFSSPKSDENNDLPSSFTGYFKKFNTGRKIISQEILNLIELRMRKGNIQLTNSAISDALKEIDSSVLNVAVTGETGSGKSSFINTLRGIGNEEEGAAKTGVVEVTMERHPYKHPNIPNVVFWDLPGIGSTNFPPNTYLEKMKFYEYDFFIIISATRFKKNDIDIAKAISMMKKEFYFVRTKVDSDITNEADGKPQTFDKEKVLQDIRLNCVNTFRENGIAEPPIFLLSNKNVCHYDFPVLMDKLISDLPIYKRHNFMVSLPNITDSVIEKKRQFLKQRIWLEGFAADLVNIIPSLTFLLDSDLETLKKSMKFYRTVFGVDETSLQRLARDWEIEVDQVEAMIKSPAVFKPTDEETIQERLSRYIQEFCLANGYLLPKNSFLKEIFYLKYYFLDMVTEDAKTLLKEICLRN
Tissue specificity:
Induction:Up-regulated by IFNG, IFNA1 and lipopolysaccharide (LPS) within 20 hours. Transiently up-regulated during the early stages of infection by Listeria monocytogenes. After 6 days expression is back to basal levels. {ECO:0000269|PubMed:11907101, ECO:0000269|PubMed:9862701}.
Developmental stage:
Protein families:TRAFAC class dynamin-like GTPase superfamily, IRG family