GP15L_MOUSE A0A0B4J1N3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A0A0B4J1N3
Recommended name:Protein GPR15L
EC number:
Alternative names:
Cleaved into:
GeneID:70045
Gene names (primary ):Gpr15l
Gene names (synonym ):
Gene names (ORF ):
Length:78
Mass:8899
Sequence:MRLLALSGLLCMLLLCFCIFSSEGRRHPAKSLKLRRCCHLSPRSKLTTWKGNHTRPCRLCRNKLPVKSWVVPGALPQI
Tissue specificity:Highly abundant in the testis, colon, eye, and tongue. Detected in the epithelial layer of the colon, but not the small intestine. {ECO:0000269|PubMed:28900043, ECO:0000269|PubMed:28936214}.
Induction:Up-regulated by Imiquimod in the skin (PubMed:28900043). {ECO:0000269|PubMed:28900043}.
Developmental stage:
Protein families: