CHIP_MOUSE   Q9WUD1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WUD1

Recommended name:STIP1 homology and U box-containing protein 1

EC number:EC 2.3.2.27

Alternative names:(Carboxy terminus of Hsp70-interacting protein) (E3 ubiquitin-protein ligase CHIP) (RING-type E3 ubiquitin transferase CHIP)

Cleaved into:

GeneID:56424

Gene names  (primary ):Stub1

Gene names  (synonym ):Chip

Gene names  (ORF ):

Length:304

Mass:34909

Sequence:MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELHSYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQLIPNLAMKEVIDAFISENGWVEDY

Tissue specificity:

Induction:Up-regulated by inflammatory signals in Treg regulatory T-cells (Treg). {ECO:0000269|PubMed:23973223}.

Developmental stage:

Protein families:


   💬 WhatsApp