IF27A_MOUSE Q8R412
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R412
Recommended name：Interferon alpha-inducible protein 27-like protein 2A
EC number：
Alternative names：(Interferon-stimulated gene 12 protein) (ISG12)
Cleaved into：
GeneID：76933
Gene names (primary )：Ifi27l2a
Gene names (synonym )：Ifi27 Isg12
Gene names (ORF )：
Length：90
Mass：7929
Sequence：MLGTLFGSAIGGALAVAGAPVALAAMGFTGTGIAAASIAAKMMSAAAIANGGGVAAGSLVATLQSAGVLGLSTSTNAILGAAGAAVGALL
Tissue specificity：
Induction：Up-regulated by interferon (PubMed:22427340). Up-regulated by vascular tissues injury (PubMed:22427340). {ECO:0000269|PubMed:22427340}.
Developmental stage：
Protein families：IFI6/IFI27 family